PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.107740.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 217aa    MW: 24805.9 Da    PI: 8.2196
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.107740.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.34.1e-141461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l   + + G g+W++++ + g+ R  k+c++rw++yl
   Cucsa.107740.2 14 KGLWSPEEDEKLRSFILKNGHGCWTSVPIKAGLLRNSKSCRLRWFNYL 61
                     678*****************************99************97 PP

2Myb_DNA-binding51.72e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg ++++Ede+++ ++++lG++ W+ Ia+++  gRt++++k++w+++l
   Cucsa.107740.2  67 RGMFSQQEDEKILTLHRLLGNR-WSQIAQHLA-GRTDNEIKNYWNSHL 112
                      788*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.866961IPR017930Myb domain
SuperFamilySSF466892.53E-2712108IPR009057Homeodomain-like
SMARTSM007177.9E-111363IPR001005SANT/Myb domain
PfamPF002497.2E-131461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-191568IPR009057Homeodomain-like
CDDcd001672.19E-81761No hitNo description
PROSITE profilePS5129425.73862116IPR017930Myb domain
SMARTSM007171.6E-1566114IPR001005SANT/Myb domain
PfamPF002496.1E-1567112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2669116IPR009057Homeodomain-like
CDDcd001671.13E-1170112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MGCRETEKEK VKKKGLWSPE EDEKLRSFIL KNGHGCWTSV PIKAGLLRNS KSCRLRWFNY  60
LRPGLKRGMF SQQEDEKILT LHRLLGNRWS QIAQHLAGRT DNEIKNYWNS HLKKKVVLNF  120
QDLKSGVFSN RDPPLEEMGS SGNERIESQP RVLFAEWLSV SDVNGGSSME GSFDGEGRRT  180
SREGYGFEML NWDLDFEGHI SDGFATCDQL CREQTG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-24141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818481e-93LN681848.1 Cucumis melo genomic scaffold, anchoredscaffold00006.
GenBankLN7132601e-93LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011652772.11e-147PREDICTED: LOW QUALITY PROTEIN: transcription factor LAF1-like
SwissprotQ9M0K45e-55LAF1_ARATH; Transcription factor LAF1
TrEMBLA0A0A0L6I11e-137A0A0A0L6I1_CUCSA; Uncharacterized protein
STRINGGLYMA10G38110.11e-61(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25560.13e-56myb domain protein 18